Kuef / Казахский университет экономики, финансов и международной торговли

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Казахский университет экономики, финансов и международной торговли
Description	Казахский университет экономики, финансов и международной торговли г. Нур-Султан Казахстан
Keywords	КазУЭФМТ, университет, экономика, финансы, международная, торговля, Нур-Султан, Астана, Казахстан, ВУЗ

Server Information

WebSite	www.kuef.edu.kz
Host IP	91.201.214.146
Location	Almaty, Almaty, Kazakhstan

Related Websites

                    Site
                    Rank
                

More to Explore

lauralampugnale.com

liceospano.edu.it

lightcliffehistory.org.uk

lightvfx.com

managehighlyrefinedthefile.vip

Kuef.edu.kz Valuation

US$231,953

Last updated: Nov 9, 2021

Kuef.edu.kz has global traffic rank of 520,216. Its global rank has gone up by 991 positions since 3 months ago. Kuef.edu.kz has an estimated worth of US$ 231,953, based on its estimated Ads revenue. Kuef.edu.kz receives approximately 6,052 unique visitors each day. Its web server is located in Almaty, Almaty, Kazakhstan, with IP address 91.201.214.146. According to SiteAdvisor, kuef.edu.kz is unknown to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$231,953
Daily Ads Revenue	US$127
Monthly Ads Revenue	US$3,812
Yearly Ads Revenue	US$46,390
Daily Unique Visitors	6,052
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	520,216
Delta (90 Days)	⬆️ 991
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
kuef.edu.kz	A	14400	IP: 91.201.214.146
kuef.edu.kz	MX	14400	Priority: 10 Target: mx.yandex.net.
kuef.edu.kz	NS	14400	Target: ns2.kuef.kz.
kuef.edu.kz	NS	14400	Target: ns1.kuef.kz.
kuef.edu.kz	SOA	14400	MNAME: ns1.kuef.kz. RNAME: admin.kuef.kz. Serial: 2018032703 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 604800

HTTP Headers

HTTP/1.1 301 Moved Permanently
Date: Tue, 09 Nov 2021 02:23:15 GMT
Server: Apache/2.4.10 (Debian)
Location: https://kuef.edu.kz/
Content-Length: 305
Content-Type: text/html; charset=iso-8859-1

Kuef.edu.kz Whois Information

Whois Server for the KZ top level domain name.
This server is maintained by KazNIC Organization, a ccTLD manager for Kazakhstan Republic.

Domain Name............: kuef.edu.kz

Organization Using Domain Name
Name...................: Abdymanapov Sarsengali Abdygalievich
Organization Name......: Kazahskiy universitet ekonomiki finansov i mezhdunarodnoy torgovli
Street Address.........: Zhubanova 7
City...................: Nur-Sultan
State..................: 010005
Postal Code............: Nur-Sultan
Country................: KZ

Administrative Contact/Agent
NIC Handle.............: Regkuef
Name...................: Abdymanapov Sarsengali Abdygalievich
Phone Number...........: +77172278571 1234
Fax Number.............: +77172371622 
Email Address..........: mailbox@kuef.kz

Nameserver in listed order

Primary server.........: ns1.kuef.kz
Primary ip address.....: 91.201.214.146

Secondary server.......: ns2.kuef.kz
Secondary ip address...: 91.201.214.146

Domain created: 2020-10-06 11:52:36 (GMT+0:00)
Last modified : 
Domain status : clientRenewProhibited - Payment overdue

Registar created: NIT.KZ
Current Registar: NIT.KZ

Kuef.edu.kz valuation and analysis